__  __    __   __  _____      _            _          _____ _          _ _ 
 |  \/  |   \ \ / / |  __ \    (_)          | |        / ____| |        | | |
 | \  / |_ __\ V /  | |__) | __ ___   ____ _| |_ ___  | (___ | |__   ___| | |
 | |\/| | '__|> <   |  ___/ '__| \ \ / / _` | __/ _ \  \___ \| '_ \ / _ \ | |
 | |  | | |_ / . \  | |   | |  | |\ V / (_| | ||  __/  ____) | | | |  __/ | |
 |_|  |_|_(_)_/ \_\ |_|   |_|  |_| \_/ \__,_|\__\___| |_____/|_| |_|\___V 2.1
 if you need WebShell for Seo everyday contact me on Telegram
 Telegram Address : @jackleet
        
        
For_More_Tools: Telegram: @jackleet | Bulk Smtp support mail sender | Business Mail Collector | Mail Bouncer All Mail | Bulk Office Mail Validator | Html Letter private



Upload:

Command:

[email protected]: ~ $
����$lI�a�aq�a_pb!�b�b	c c6cHc`cwc�c�c�c-�c�c-d$0dUdod
d	�d�d�d%�d$�d%e&e:eBeGePeaeCxe"�e�e)�e&!fHf
`fnf	wf	�f�f�f�f�f�f�f�f�fgFg`gmgtg�g�g�g�g�g
�g�ghh*h9hIhW`hY�hii4iLieixi�i4�i�i�i�i�ij
jj!j8jWj`j	vj�j�j	�j
�j	�j+�j	�jT�j?kGkNk"]k�k�k�k�k�k
�k
ll"l6l>lUlol�l�l"�l�l�lmm#m4mLm(gm�m,�m#�m#n%n@n#Hn"ln�n�n�n�n�n$o?'o%go�o$�o�o%�o�o
p	p(p Apbpjpyp�p�p�p �p 
q	.qJ8q>�qE�qrr-rFr9\r.�r@�r@sGGsT�s"�stt#t<t\tst�t�t�t�t�t�tu
uu)u1uAu
NuYunu�u�u�u�u�u�uvv-vGvevv�v%�v$�v!�vw+*w-Vw
�w�w
�w�w�w�w"�wx"x:x
Zxhx |x�x�x�x�x�x�x	y y=ySyey{y�y�y�y�y�y�yzz,z@zWz_zqzwz�z�z�z�z�z*�z#{6{C{X{k{|{$�{A�{;�{.1|(`|�|�|�|�|'�|}}=}M}e}�}�}�}�}�}�}~%~2~H~)]~�~�~%�~�~#�~#0Oj�3�@�#�4�(F�o�%����4ʀ���	�)�D�3a�������$ȁ�.�	4�	>�	H�	R�\�l�p�u�}���$��!‚(�%
�3�P�j�������
Ãу���
��1�'Q�y���%��ф���$�2*�]�m������)�����	��0�A�W�l�"��"��(҆
��	� �=>�
|�����!‡�#��)�H�^�z���������Èވ��& �G�b�s��� ������Љ����3�$R�
w��������� Ԋ����,�<�R�g�"����"Nj(�� �@�T�n���0��Ɍ� ���)�>�O�d�v�������
����
Ѝލ����-�:�L�e�&����Ɏ"��,�L�l�������̏ݏ
���	�&�)E�$o�'��&��)�$
�'2�&Z�)��$��'Б&��)�$I�'n�����’ג����#�C� `�	��������ғ�
��"�9�O�	o�y����������ɔ"���5�
L�Z�c�u�������•ӕ%�&�6�P�W�p�x�	��������Ė!ږ���0�B�S�Z�b�g�n�������ڗ�� �=�O�k�������̘���� �'�9�#=�a�i�u���(��ʙޙ"�� �2�G�d�u�)��-�������87�!p���	����4›���D�
d�o�x�e��7��/�6�F�\�
p�{�������.ם(�/�E�N�^� x��� ��#ڞ!��( � I�+j�%����Ο��'�9�I�^�n�%��)��
ݠ���
2�=�	W�
a�4o�&�� ˡ"�%�%5�"[�&~�����ܢ��a�w���	����)ʣ����&�,�F�K�Z�s���)����Ĥڤ���(� ;�\�n� ����&��"�)�5�O�"a�#����	����	̦֦�&���*3�#^�����$��#����(�4�M�#T�#x�=��Mڨ#(�ML�^�����%*�P�h�	~�������#Ū���0�S9�&��&��۫1��,�1�9�
?�M�
V�d�!j�������Ŭˬ۬�����  �A�_�f�����,��4έ�"�5�E�[�z���
����Į(�,	�6�!R�!t�����$¯*�$�7�K�e������Ӱٰ��	�&�@�f\�!ñ%�
��1�I�`�	l�v�f����� �4�L�`�s�����
³ͳճ
����+�"J�!m���!��"Ŵ#��#�(>�g� ~�����͵����2�!M�o�����+���
��
�
�*�<�N�i�~�
������"��&ܷ�#�3�K� d���0��Ǹ$۸�9�R�b�k�������"��չ�*��#*�N�d�	��&����ͺպ�,��!,� N�$o�&��,������&�;�R�7o���Ǽݼ�
�#�4�P�_�*y�����ѽ���#�@�]�|�������þ׾�"�"$�G�^�t�������	��˿�����-(�(V��"��$���������&�+�=�Q�Y�,w�+��+����(�;<�dx��������&�6�B�T�k�������������.�*B�m�t�	������������� �-7�Ne������������$�&4�+[�+������������
�
� �,5�b�(w���B��c��(a�	������������&��K��e<�u��o�J��o��JC�������������������������������������������������������������������!�$�'�*�-�0�6�:�>�A�D�G�J�M�P�S�V�Y�\�_�c�f�i�l�s�v�y�|��������������������������������������������������������������������������������������������!�%�(�+�.�1�4�7�:�>�A�D��G��h9�r��(�>�]�$y�����"������0�;4�"p�1��/����)�
=�	K�U�g�4v� ��+������	�"�3�LJ�.��#��E��B0�'s�����
����&�������%'�M�#S�"w�"��_���-�4�D�]�n�����
�������������V*�U���������7�J�^�-s�����������	��
��")�L�U�	k�u���	��
��	��-����f��J�
R�]�$n�����������
�*�>�S�Y�!n�����"�������6�C�T�e�~�3��)��1��',�'T�|�����.�����&�>�W�/r�N��/��!�%)�O�"_�����	���� ������ � #� D�e�'}�'����`��HE�J������
�*�YH�H��K��K7�J��p��)?�i�r������������ �1�A�Q�a�
g�r������������������3�N�g�{����� ������$�#C�g���P��G��7�R�l�x�~���%����#��,�3�G�![�}��� ����������&��&�<�T�+p�����!������	�&�3�@�T�o�w�
��������!�����)�,D�q�~�������)��U��KO�=��3��
��.�*?�2j����������# �D�$X�&}������������,�B�Z�*u���.���� ���+9�"e�=��J��2�D�3W���4����A��<�L�	j�t���6��������%�9�DV��������������������$�"<�(_�&��������5�<�M�a�x�����)��0��:�5Z�"������*�9��3�F�Z�m���,������
�'�<�T�e���$��'����5�=M���%��*�-�!�3A�6u��� �����"�%�=�\�t���(������	�"�;�N�_�w�������%�(��)(�R�
c�q�'�����������!�<�Z�#s�&����4�6N3k��"���	2Ncs|�
��
��� �*="V"y��"��<\|����
��	)-9*g.�)�-�*.D)s-�*�.�)%-O*}.���(EVjz� �
���+!Jlq"w� �	��
��		#	8	'P	x	)�	�	�	�	�	

'
<
Q
i
)
*�
�
�
#�
%AIP`s,�$�&�� '/4#<`w�����
#
>
U
f
�
�
�
�
�
�
�
,=EQg0�&�*�/Ca'r3�7�#
9&G~n;� )JYVr!�(�t�
�1�`�Y;�������/5%e���� �� #5!Y-{ �+�4�+=So'����'�%++Wcx�	��	��D�+2%^'�-�*�')-&W%~'�&�w�k�	��0��(�/6QVe~�(��'�/�',Tq��� ��2:)T~�&�&��� 0'=e1$���%#7[gs��5�4�M sg 4� r!��!"0".K"z"�"�"�"�"�"'�"#(#A#	^#�h#,�#,$5E$M{$�$�$�$�$�$�$%!%.%?%W%h%n%�%�%�%�%�%�%#�%&&1&B&/R&9�&+�&�&�&')$'N'_'~'�'�'(�'4�'(!5('W((�(*�(-�(,)1)E)_)")�)�)�)�)�)*)*$5**Z*X�*0�*:+J+%W+}+�+�+�+)�+^,a,h,%z,�,�,�,)�,	-$-
7-E-J-
b-m-|-�-�-�-�- . ".!C.e.y.+�.�.�.�./!/9/J/c/}/$�/�/$�/�//0N0
b0p0	�0�0�0�0�0
�0�0�01!1+=1i1�1�1�1�1�13�1+2/A2q2:�2�2	�2�2	�2#3,3)33]3s34|3�3(�3�3 4%4'.4V4	p4z4�4/�4#�4"�405.O55~5�5�5�5�56 16AR6�6�6#�6'�6#767(G7p7&7=�7#�788/8B8b89�8=�89�8 39T9Z9l9{9�9�9!�9-�9::7:T:l:r:	�:�:�:�:�: �:3�:,#;P;3e;*�;�;�;�;�;�;<<4<O<X<0w</�</�<= =?=0^=c�=�=>>->4>
:>	H>R>c>(x>�>
�>�>�>�>?.6?*e?�?�?	�?�?�?�?@"@8@ S@5t@i�@A#A4ALAbAxA�A>�A>�AJ$B oB�B�B�B�B�B
�B�B,�B*C+?CkCT�C��CWcD�D�D�D�D�DEM
E�[E��E�|F�2G��G�vH�>I�I�I�I�I�I�I�I�I�I�I�I�I�I�I�I�IJJJ
JJJJJJJ%J)J,J/JIJLJOJRJUJXJ[J^JaJdJgJjJpJtJxJ{J~J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�J�JKK	KKKKKKKK"K&K)K-K0K3K6K9K<K?KBKFKIKLKOKRKUKXK[K_KbKeKhKkKnKqKtKxK{K~K�h'�%M��x�T �&�J��HG��M�%g���_��U#
�vf��c�E�\���Yk���H-{���w��ir5%)n'��'(��sQY����������},]32��u�!w��x@$p�Y�4mHqP"������N?��`C��D�4;d4(�0#z�� j�PQ��y^�SU���Td��W]��@�vS.������i���f�CRW��7�fg�l�)���J\F����(�R0g�6oHP��pp*��b:c<�ors��_&��n�>�eMK����t�|u
�oj�&k/+�3��p�u�P�B��Jb�B/��|���\H��s���m����J��U��$UR�;V�5�$���IE�6E
��*5���a��V8��=��ujK
Y(�=V]��[��/[|-��^=���
�L��:�kq+<�8DL/���e��9�RME[>s�"^�F�gc}�����l�.Z�{V���,�3��,8�m	�BKI��%;M�;<Jb��"�f�����g��U��CN��G��"����1b ���9~Z��>o��~���	3O�F��Q]�����|~���h�[]A��+V����(��A����e�_
*�D1F�O��w-qX$\��^��������T������a���{���C��r����I!�$��6�!Y�51��������X@�[O��iO�?�����t�l�`�z<p�)���h����@���9���	}8�����4�QQ7�_7z��S�
i��1��k����1�
}���G��X*B�mZI	�KsR+��N�2�j��&v�yZ�q�����L2?�����
�l����6v��v_�a�c�`�q-�.my{e�i���������w������,F�G/�-~�t#>oad�?r����!�5xL���2�{�t������P�dS)x3�! ��2��4��Lf%�����|�)��`�<�?���,:n����0#�Z�&�����ruwS0*X�.K7�n��T��z��7A�=E�AhB��z Tt�G���ax@����0;�lyn:��9�D��c+��d�>#���=�"�
�C��W��jb����h�X��OI���N:'�y����\W�8��`e��A���'}�N~�����^6�����kD��9	W.&lt;Less/Greater&gt;&lt;Less/Greater&gt; chooses 5th level; acts as onetime lock when pressed together with another 5th level chooser&lt;Less/Greater&gt;; acts as onetime lock when pressed together with another 3rd level chooser3rd level of &lt;Less/Greater&gt;3rd level of Caps Lock3rd level of Left Ctrl3rd level of Left Win3rd level of Menu3rd level of Right Ctrl3rd level of Right WinA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLAPL Keyboard Symbols: APLX Unified APL LayoutAPL Keyboard Symbols: IBM APL2APL Keyboard Symbols: Manugistics APL*PLUS IIAPL Keyboard Symbols: Unified LayoutAPL Keyboard Symbols: saxATM/phone-styleAcer AirKey VAcer C300Acer Ferrari 4000Acer laptopAdd the standard behavior to Menu keyAdding Esperanto supersigned lettersAdding currency signs to certain keysAdvance Scorpius KIAfghaniAkanAlbanianAlbanian (Plisi)Albanian (Veqilharxhi)Allow breaking grabs with keyboard actions (warning: security risk)Allow grab and window tree loggingAlt and Meta are on AltAlt is mapped to Right Win, Super to MenuAlt is mapped to Win and the usual AltAlt is swapped with WinAlt+Caps LockAlt+CtrlAlt+ShiftAlt+SpaceAlt/Win key behaviorAmharicAny AltAny WinAny Win (while pressed)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium: emulate PC keys (PrtSc, Scroll Lock, Pause, Num Lock)Apple laptopArabicArabic (AZERTY)Arabic (AZERTY/digits)Arabic (Algeria)Arabic (Buckwalter)Arabic (Macintosh)Arabic (Morocco)Arabic (OLPC)Arabic (Pakistan)Arabic (QWERTY)Arabic (Sun Type 6/7)Arabic (Syria)Arabic (digits)Arabic (qwerty/digits)Arabic (with extensions for Arabic-written other languages and Arabic digits preferred)Arabic (with extensions for Arabic-written other languages and European digits preferred)ArmenianArmenian (OLPC phonetic)Armenian (alt. eastern)Armenian (alt. phonetic)Armenian (eastern)Armenian (phonetic)Armenian (western)Asturian (Spain, with bottom-dot H and bottom-dot L)Asus laptopAt bottom leftAt left of 'A'AtsinaAvatimeAvestanAzerbaijaniAzerbaijani (Cyrillic)Azona RF2300 wireless InternetBTC 5090BTC 5113RF MultimediaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBackslashBackslash; acts as onetime lock when pressed together with another 3rd level chooserBambaraBanglaBangla (India)Bangla (India, Baishakhi Inscript)Bangla (India, Baishakhi)Bangla (India, Bornona)Bangla (India, Probhat)Bangla (India, Uni Gitanjali)Bangla (Probhat)BashkirianBelarusianBelarusian (Latin)Belarusian (legacy)BelgianBelgian (Sun Type 6/7)Belgian (Wang 724 AZERTY)Belgian (alt. ISO)Belgian (alt.)Belgian (alt., Latin-9 only)Belgian (alt., with Sun dead keys)Belgian (no dead keys)Belgian (with Sun dead keys)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berber (Algeria, Latin)Berber (Algeria, Tifinagh)Berber (Morocco, Tifinagh alt. phonetic)Berber (Morocco, Tifinagh alt.)Berber (Morocco, Tifinagh extended phonetic)Berber (Morocco, Tifinagh extended)Berber (Morocco, Tifinagh phonetic)Berber (Morocco, Tifinagh)BosnianBosnian (US, with Bosnian digraphs)Bosnian (US, with Bosnian letters)Bosnian (with Bosnian digraphs)Bosnian (with guillemets)Both Alt togetherBoth Ctrl togetherBoth Shift togetherBoth Shift together enable Caps LockBoth Shift together enable Caps Lock; one Shift key disables itBoth Shift together enable Shift LockBrailleBraille (left-handed inverted thumb)Braille (left-handed)Braille (right-handed inverted thumb)Braille (right-handed)Brother InternetBulgarianBulgarian (new phonetic)Bulgarian (traditional phonetic)BurmeseBurmese ZawgyiCameroon Multilingual (AZERTY)Cameroon Multilingual (Dvorak)Cameroon Multilingual (QWERTY)Canadian MultilingualCanadian Multilingual (1st part)Canadian Multilingual (2nd part)Caps LockCaps Lock (while pressed), Alt+Caps Lock for the original Caps Lock actionCaps Lock acts as Shift with locking; Shift "pauses" Caps LockCaps Lock acts as Shift with locking; Shift does not affect Caps LockCaps Lock as CtrlCaps Lock behaviorCaps Lock is also a CtrlCaps Lock is disabledCaps Lock to first layout; Shift+Caps Lock to last layoutCaps Lock toggles ShiftLock (affects all keys)Caps Lock toggles normal capitalization of alphabetic charactersCaps Lock uses internal capitalization; Shift "pauses" Caps LockCaps Lock uses internal capitalization; Shift does not affect Caps LockCaps Lock; acts as onetime lock when pressed together with another 3rd-level chooserCatalan (Spain, with middle-dot L)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@rdCherry Blue Line CyBo@rd (alt.)Cherry CyBo@rd USB-HubCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony InternetChicony KB-9885Chicony KU-0108Chicony KU-0420ChineseChromebookChurch SlavonicChuvashChuvash (Latin)Classmate PCCloGaelachCoeur d'Alene SalishCompaq Armada laptopCompaq Easy AccessCompaq Internet (13 keys)Compaq Internet (18 keys)Compaq Internet (7 keys)Compaq Presario laptopCompaq iPaqComposeCreative Desktop Wireless 7000Crimean Tatar (Dobruja Q)Crimean Tatar (Turkish Alt-Q)Crimean Tatar (Turkish F)Crimean Tatar (Turkish Q)CroatianCroatian (US, with Croatian digraphs)Croatian (US, with Croatian letters)Croatian (with Croatian digraphs)Croatian (with guillemets)Ctrl is mapped to Alt; Alt is mapped to WinCtrl is mapped to Win and the usual Ctrl keysCtrl positionCtrl+Alt+BackspaceCtrl+ShiftCzechCzech (QWERTY)Czech (QWERTY, Macintosh)Czech (QWERTY, extended backslash)Czech (Sun Type 6/7)Czech (UCW, only accented letters)Czech (US, Dvorak, UCW support)Czech (coder)Czech (programming)Czech (programming, typographic)Czech (typographic)Czech (with &lt;\|&gt; key)Czech Slovak and German (US)DTK2000DanishDanish (Dvorak)Danish (Macintosh)Danish (Macintosh, no dead keys)Danish (Sun Type 6/7)Danish (Win keys)Danish (no dead keys)Default numeric keypad keysDellDell 101-key PCDell Inspiron 6000/8000 laptopDell Latitude laptopDell Precision M laptopDell Precision M65 laptopDell SK-8125Dell SK-8135Dell USB MultimediaDexxa Wireless DesktopDhivehiDiamond 9801/9802DutchDutch (Macintosh)Dutch (Sun Type 6/7)Dutch (standard)Dutch (with Sun dead keys)Dyalog APL completeDzongkhaElfdalian (Swedish, with combining ogonek)Enable extra typographic charactersEnglish (3l)English (Australian)English (Cameroon)English (Canada)English (Carpalx)English (Carpalx, full optimization)English (Carpalx, full optimization, intl., with AltGr dead keys)English (Carpalx, full optimization, intl., with dead keys)English (Carpalx, intl., with AltGr dead keys)English (Carpalx, intl., with dead keys)English (Colemak)English (Drix)English (Dvorak)English (Dvorak, alt. intl.)English (Dvorak, intl., with dead keys)English (Dvorak, left-handed)English (Dvorak, right-handed)English (Ghana)English (Ghana, GILLBT)English (Ghana, multilingual)English (India, with rupee)English (Macintosh)English (Mali, US, Macintosh)English (Mali, US, intl.)English (Nigeria)English (Norman)English (South Africa)English (UK)English (UK, Colemak)English (UK, Dvorak)English (UK, Dvorak, with UK punctuation)English (UK, Macintosh)English (UK, Sun Type 6/7)English (UK, extended, with Win keys)English (UK, intl., Macintosh)English (UK, intl., with dead keys)English (US)English (US, IBM Arabic 238_L)English (US, Sun Type 6/7)English (US, alt. intl.)English (US, euro on 5)English (US, international AltGr Unicode combining)English (US, international AltGr Unicode combining, alternative)English (US, intl., with dead keys)English (Workman)English (Workman, intl., with dead keys)English (classic Dvorak)English (intl., with AltGr dead keys)English (programmer Dvorak)English (the divide/multiply keys toggle the layout)Ennyah DKB-1008Enter on keypadEsperantoEsperanto (Brazil, Nativo)Esperanto (Portugal, Nativo)Esperanto (displaced semicolon and quote, obsolete)EstonianEstonian (Dvorak)Estonian (Sun Type 6/7)Estonian (US, with Estonian letters)Estonian (no dead keys)EurKEY (US based layout with European letters)Euro on 2Euro on 4Euro on 5Euro on EEverex STEPnoteEweFL90FaroeseFaroese (no dead keys)FilipinoFilipino (Capewell-Dvorak, Baybayin)Filipino (Capewell-Dvorak, Latin)Filipino (Capewell-QWERF 2006, Baybayin)Filipino (Capewell-QWERF 2006, Latin)Filipino (Colemak, Baybayin)Filipino (Colemak, Latin)Filipino (Dvorak, Baybayin)Filipino (Dvorak, Latin)Filipino (QWERTY, Baybayin)FinnishFinnish (DAS)Finnish (Dvorak)Finnish (Macintosh)Finnish (Sun Type 6/7)Finnish (Winkeys)Finnish (classic)Finnish (classic, no dead keys)Four-level key with abstract separatorsFour-level key with commaFour-level key with dotFour-level key with dot, Latin-9 onlyFour-level key with momayyezFrenchFrench (AZERTY)French (Bepo, ergonomic, Dvorak way)French (Bepo, ergonomic, Dvorak way, Latin-9 only)French (Breton)French (Cameroon)French (Canada)French (Canada, Dvorak)French (Canada, legacy)French (Democratic Republic of the Congo)French (Dvorak)French (Guinea)French (Macintosh)French (Mali, alt.)French (Morocco)French (Sun Type 6/7)French (Switzerland)French (Switzerland, Macintosh)French (Switzerland, Sun Type 6/7)French (Switzerland, no dead keys)French (Switzerland, with Sun dead keys)French (Togo)French (US, AZERTY)French (US, with French letters)French (US, with French letters, with dead keys, alternative)French (alt.)French (alt., Latin-9 only)French (alt., no dead keys)French (alt., with Sun dead keys)French (legacy, alt.)French (legacy, alt., no dead keys)French (legacy, alt., with Sun dead keys)French (no dead keys)French (with Sun dead keys)Friulian (Italy)Fujitsu-Siemens Amilo laptopFulaGaGeneric 101-key PCGeneric 102-key PC (intl.)Generic 104-key PCGeneric 105-key PC (intl.)Genius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGeorgianGeorgian (France, AZERTY Tskapo)Georgian (Italy)Georgian (MESS)Georgian (ergonomic)GermanGerman (Aus der Neo-Welt)German (Austria)German (Austria, Macintosh)German (Austria, no dead keys)German (Austria, with Sun dead keys)German (Bone)German (Bone, eszett home row)German (Dvorak)German (KOY)German (Macintosh)German (Macintosh, no dead keys)German (Neo 2)German (Neo qwerty)German (Neo qwertz)German (QWERTY)German (Sun Type 6/7)German (Switzerland)German (Switzerland, Macintosh)German (Switzerland, Sun Type 6/7)German (Switzerland, legacy)German (Switzerland, no dead keys)German (Switzerland, with Sun dead keys)German (T3)German (US, with German letters)German (dead acute)German (dead grave acute)German (dead tilde)German (no dead keys)German (with Hungarian letters and no dead keys)German (with Sun dead keys)German LadinGerman, Swedish and Finnish (US)GreekGreek (Colemak)Greek (Sun Type 6/7)Greek (extended)Greek (no dead keys)Greek (polytonic)Greek (simple)GujaratiGyrationHanyu Pinyin (altgr)Happy HackingHappy Hacking for MacHausa (Ghana)Hausa (Nigeria)HebrewHebrew (Biblical, SIL phonetic)Hebrew (Biblical, Tiro)Hebrew (lyx)Hebrew (phonetic)Hewlett-Packard InternetHewlett-Packard Mini 110 laptopHewlett-Packard NEC SK-2500 MultimediaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020HexadecimalHindi (Bolnagri)Hindi (KaGaPa phonetic)Hindi (Wx)Honeywell EuroboardHungarianHungarian (101/QWERTY/comma/dead keys)Hungarian (101/QWERTY/comma/no dead keys)Hungarian (101/QWERTY/dot/dead keys)Hungarian (101/QWERTY/dot/no dead keys)Hungarian (101/QWERTZ/comma/dead keys)Hungarian (101/QWERTZ/comma/no dead keys)Hungarian (101/QWERTZ/dot/dead keys)Hungarian (101/QWERTZ/dot/no dead keys)Hungarian (102/QWERTY/comma/dead keys)Hungarian (102/QWERTY/comma/no dead keys)Hungarian (102/QWERTY/dot/dead keys)Hungarian (102/QWERTY/dot/no dead keys)Hungarian (102/QWERTZ/comma/dead keys)Hungarian (102/QWERTZ/comma/no dead keys)Hungarian (102/QWERTZ/dot/dead keys)Hungarian (102/QWERTZ/dot/no dead keys)Hungarian (QWERTY)Hungarian (no dead keys)Hungarian (standard)Hyper is mapped to WinIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIcelandicIcelandic (Dvorak)Icelandic (Macintosh)Icelandic (Macintosh, legacy)Icelandic (no dead keys)Icelandic (with Sun dead keys)IgboIndianIndonesian (Arab Melayu, phonetic)Indonesian (Javanese)International Phonetic AlphabetInuktitutIraqiIrishIrish (UnicodeExpert)ItalianItalian (IBM 142)Italian (Macintosh)Italian (Sun Type 6/7)Italian (US, with Italian letters)Italian (Winkeys)Italian (intl., with dead keys)Italian (no dead keys)Italian LadinJapaneseJapanese (Dvorak)Japanese (Kana 86)Japanese (Kana)Japanese (Macintosh)Japanese (OADG 109A)Japanese (PC-98)Japanese (Sun Type 6)Japanese (Sun Type 7 - pc compatible)Japanese (Sun Type 7 - sun compatible)Japanese keyboard optionsKalmykKana Lock key is lockingKannadaKannada (KaGaPa phonetic)KashubianKazakhKazakh (Latin)Kazakh (extended)Kazakh (with Russian)Key sequence to kill the X serverKey to choose 5th levelKey to choose the 3rd levelKeytronic FlexProKhmer (Cambodia)KikuyuKinesisKomiKoreanKorean (101/104 key compatible)Korean (Sun Type 6/7)Korean Hangul/Hanja keysKurdish (Iran, Arabic-Latin)Kurdish (Iran, F)Kurdish (Iran, Latin Alt-Q)Kurdish (Iran, Latin Q)Kurdish (Iraq, Arabic-Latin)Kurdish (Iraq, F)Kurdish (Iraq, Latin Alt-Q)Kurdish (Iraq, Latin Q)Kurdish (Syria, F)Kurdish (Syria, Latin Alt-Q)Kurdish (Syria, Latin Q)Kurdish (Turkey, F)Kurdish (Turkey, Latin Alt-Q)Kurdish (Turkey, Latin Q)KutenaiKyrgyzKyrgyz (phonetic)LaoLao (STEA proposed standard layout)LatvianLatvian (F)Latvian (Sun Type 6/7)Latvian (US Colemak)Latvian (US Colemak, apostrophe variant)Latvian (US Dvorak)Latvian (US Dvorak, Y variant)Latvian (US Dvorak, minus variant)Latvian (adapted)Latvian (apostrophe)Latvian (ergonomic, ŪGJRMV)Latvian (modern)Latvian (programmer US Dvorak)Latvian (programmer US Dvorak, Y variant)Latvian (programmer US Dvorak, minus variant)Latvian (tilde)Layout of numeric keypadLeft AltLeft Alt (while pressed)Left Alt as Ctrl, Left Ctrl as Win, Left Win as Left AltLeft Alt is swapped with Left WinLeft Alt+Left ShiftLeft CtrlLeft Ctrl as MetaLeft Ctrl to first layout; Right Ctrl to last layoutLeft Ctrl+Left ShiftLeft Ctrl+Left WinLeft Ctrl+Left Win to first layout; Right Ctrl+Menu to second layoutLeft ShiftLeft WinLeft Win (while pressed)Left Win chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserLeft Win to first layout; Right Win/Menu to last layoutLegacyLegacy Wang 724Legacy key with commaLegacy key with dotLithuanianLithuanian (IBM LST 1205-92)Lithuanian (LEKP)Lithuanian (LEKPa)Lithuanian (Sun Type 6/7)Lithuanian (US Dvorak with Lithuanian letters)Lithuanian (US, with Lithuanian letters)Lithuanian (standard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (alt.)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (2nd alt.)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorLogitech G15 extra keys via G15daemonLogitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE USBLower SorbianLower Sorbian (QWERTZ)MacBook/MacBook ProMacBook/MacBook Pro (intl.)MacedonianMacedonian (no dead keys)MacintoshMacintosh OldMaintain key compatibility with old Solaris keycodesMake Caps Lock an additional BackspaceMake Caps Lock an additional EscMake Caps Lock an additional HyperMake Caps Lock an additional Menu keyMake Caps Lock an additional Num LockMake Caps Lock an additional SuperMake Zenkaku Hankaku an additional EscMake right Alt a Hangul keyMake right Alt a Hanja keyMake right Ctrl a Hangul keyMake right Ctrl a Hanja keyMake unmodified Caps Lock an additional Esc, but Shift + Caps Lock behaves like regular Caps LockMalay (Jawi, Arabic Keyboard)Malay (Jawi, phonetic)MalayalamMalayalam (Lalitha)Malayalam (enhanced Inscript, with rupee)MalteseMaltese (with US layout)Manipuri (Eeyek)MaoriMarathi (KaGaPa phonetic)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenuMenu (while pressed), Shift+Menu for MenuMenu as Right CtrlMenu is mapped to WinMeta is mapped to Left WinMeta is mapped to WinMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (Swedish)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB/Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Microsoft Office KeyboardMicrosoft SurfaceMicrosoft Wireless Multimedia 1.0AMiscellaneous compatibility optionsMmuockMoldavianMoldavian (Gagauz)MongolianMongolian (Bichig)MontenegrinMontenegrin (Cyrillic with guillemets)Montenegrin (Cyrillic)Montenegrin (Cyrillic, ZE and ZHE swapped)Montenegrin (Latin with guillemets)Montenegrin (Latin, QWERTY)Montenegrin (Latin, Unicode)Montenegrin (Latin, Unicode, QWERTY)Multilingual (Canada, Sun Type 6/7)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100NICOLA-F style BackspaceNepaliNon-breaking space at the 2nd levelNon-breaking space at the 3rd levelNon-breaking space at the 3rd level, nothing at the 4th levelNon-breaking space at the 3rd level, thin non-breaking space at the 4th levelNon-breaking space at the 4th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th level (via Ctrl+Shift)Northern Saami (Finland)Northern Saami (Norway)Northern Saami (Norway, no dead keys)Northern Saami (Sweden)Northgate OmniKey 101NorwegianNorwegian (Colemak)Norwegian (Dvorak)Norwegian (Macintosh)Norwegian (Macintosh, no dead keys)Norwegian (Sun Type 6/7)Norwegian (Win keys)Norwegian (no dead keys)Num LockNum Lock on: digits; Shift for arrow keys. Num Lock off: arrow keys (as in Windows)Number key 4 when pressed in isolationNumber key 9 when pressed in isolationNumeric keypad Delete behaviorNumeric keypad always enters digits (as in macOS)OLPCOccitanOghamOgham (IS434)Ol ChikiOld HungarianOriyaOrtek Multimedia/Internet MCK-800Ossetian (Georgia)Ossetian (Win keys)Ossetian (legacy)PC-98Pannonian RusynParentheses positionPashtoPashto (Afghanistan, OLPC)PausePersianPersian (Afghanistan, Dari OLPC)Persian (with Persian keypad)PolishPolish (British keyboard)Polish (Colemak)Polish (Dvorak)Polish (Dvorak, with Polish quotes on key 1)Polish (Dvorak, with Polish quotes on quotemark key)Polish (Germany, no dead keys)Polish (Glagolica)Polish (QWERTZ)Polish (Sun Type 6/7)Polish (intl., with dead keys)Polish (legacy)Polish (programmer Dvorak)PortuguesePortuguese (Brazil)Portuguese (Brazil, Dvorak)Portuguese (Brazil, IBM/Lenovo ThinkPad)Portuguese (Brazil, Nativo for US keyboards)Portuguese (Brazil, Nativo)Portuguese (Brazil, Sun Type 6/7)Portuguese (Brazil, no dead keys)Portuguese (Colemak)Portuguese (Macintosh)Portuguese (Macintosh, no dead keys)Portuguese (Macintosh, with Sun dead keys)Portuguese (Nativo for US keyboards)Portuguese (Nativo)Portuguese (Sun Type 6/7)Portuguese (no dead keys)Portuguese (with Sun dead keys)Position of Compose keyPropeller Voyager KTEZ-1000PrtScPunjabi (Gurmukhi Jhelum)Punjabi (Gurmukhi)QTronix Scorpius 98N+Right AltRight Alt (while pressed)Right Alt chooses 5th levelRight Alt chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserRight Alt never chooses 3rd levelRight Alt; Shift+Right Alt as ComposeRight CtrlRight Ctrl (while pressed)Right Ctrl as Right AltRight Ctrl+Right ShiftRight ShiftRight WinRight Win (while pressed)Right Win chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserRomanianRomanian (Germany)Romanian (Germany, no dead keys)Romanian (Sun Type 6/7)Romanian (Win keys)Romanian (cedilla)Romanian (ergonomic Touchtype)Romanian (standard cedilla)Romanian (standard)Rupee on 4RussianRussian (Czech, phonetic)Russian (DOS)Russian (Georgia)Russian (Germany, phonetic)Russian (Germany, recommended)Russian (Germany, transliteration)Russian (Kazakhstan, with Kazakh)Russian (Macintosh)Russian (Poland, phonetic Dvorak)Russian (Polyglot and Reactionary)Russian (Rulemak, phonetic Colemak)Russian (Sun Type 6/7)Russian (Sweden, phonetic)Russian (Sweden, phonetic, no dead keys)Russian (US, phonetic)Russian (Ukraine, standard RSTU)Russian (legacy)Russian (phonetic Macintosh)Russian (phonetic yazherty)Russian (phonetic)Russian (phonetic, AZERTY)Russian (phonetic, Dvorak)Russian (phonetic, French)Russian (phonetic, with Win keys)Russian (typewriter)Russian (typewriter, legacy)Russian (with US punctuation)Russian (with Ukrainian-Belorussian layout)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taiwan)SamogitianSamsung SDM 4500PSamsung SDM 4510PSanskrit (KaGaPa phonetic)Sanwa Supply SKB-KG3Scroll LockSecwepemctsinSemicolon on third levelSerbianSerbian (Cyrillic with guillemets)Serbian (Cyrillic, ZE and ZHE swapped)Serbian (Latin with guillemets)Serbian (Latin)Serbian (Latin, QWERTY)Serbian (Latin, Unicode)Serbian (Latin, Unicode, QWERTY)Serbian (Russia)Serbian (combining accents instead of dead keys)Serbo-Croatian (US)Shift + Num Lock enables PointerKeysShift cancels Caps LockShift does not cancel Num Lock, chooses 3rd level insteadShift+Caps LockSicilianSicilian (US keyboard)SilesianSilvercrest Multimedia WirelessSindhiSinhala (US, with Sinhala letters)Sinhala (phonetic)SlovakSlovak (ACC layout, only accented letters)Slovak (QWERTY)Slovak (QWERTY, extended backslash)Slovak (Sun Type 6/7)Slovak (extended backslash)SlovenianSlovenian (US, with Slovenian letters)Slovenian (with guillemets)SpanishSpanish (Dvorak)Spanish (Latin American)Spanish (Latin American, Colemak for gaming)Spanish (Latin American, Colemak)Spanish (Latin American, Dvorak)Spanish (Latin American, dead tilde)Spanish (Latin American, no dead keys)Spanish (Latin American, with Sun dead keys)Spanish (Macintosh)Spanish (Sun Type 6/7)Spanish (Win keys)Spanish (dead tilde)Spanish (no dead keys)Spanish (with Sun dead keys)Special keys (Ctrl+Alt+&lt;key&gt;) handled in a serverSteelSeries Apex 300 (Apex RAW)Sun Key compatibilitySun Type 6 (Japanese)Sun Type 6 USB (Japanese)Sun Type 6 USB (Unix)Sun Type 6/7 USBSun Type 6/7 USB (European)Sun Type 7 USBSun Type 7 USB (European)Sun Type 7 USB (Japanese)/Japanese 106-keySun Type 7 USB (Unix)Super Power MultimediaSwahili (Kenya)Swahili (Tanzania)Swap Ctrl and Caps LockSwap ESC and Caps LockSwap Left Alt with Left CtrlSwap Left Win with Left CtrlSwap Right Win with Right CtrlSwap with square bracketsSwedishSwedish (Dvorak A5)Swedish (Dvorak)Swedish (Macintosh)Swedish (Sun Type 6/7)Swedish (Svdvorak)Swedish (US, with Swedish letters)Swedish (based on US Intl. Dvorak)Swedish (no dead keys)Swedish Sign LanguageSwitching to another layoutSymplon PaceBook tabletSyriacSyriac (phonetic)TaiwaneseTaiwanese (indigenous)TajikTajik (legacy)Tamil (Inscript)Tamil (Sri Lanka, TamilNet '99)Tamil (Sri Lanka, TamilNet '99, TAB encoding)Tamil (TamilNet '99 with Tamil numerals)Tamil (TamilNet '99)Tamil (TamilNet '99, TAB encoding)Tamil (TamilNet '99, TSCII encoding)Targa Visionary 811TatarTeluguTelugu (KaGaPa phonetic)Telugu (Sarala)ThaiThai (Pattachote)Thai (TIS-820.2538)TibetanTibetan (with ASCII numerals)To the corresponding key in a Colemak layoutTo the corresponding key in a Dvorak layoutTo the corresponding key in a QWERTY layoutToshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Truly Ergonomic Computer Keyboard Model 227 (Wide Alt keys)Truly Ergonomic Computer Keyboard Model 229 (Standard sized Alt keys, additional Super and Menu key)Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurkishTurkish (Alt-Q)Turkish (F)Turkish (Germany)Turkish (Sun Type 6/7)Turkish (intl., with dead keys)Turkish (with Sun dead keys)TurkmenTurkmen (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (102/105:EU mode)TypeMatrix EZ-Reach 2030 USB (106:JP mode)UdmurtUgaritic instead of ArabicUkrainianUkrainian (Sun Type 6/7)Ukrainian (Win keys)Ukrainian (homophonic)Ukrainian (legacy)Ukrainian (phonetic)Ukrainian (standard RSTU)Ukrainian (typewriter)Unicode additions (arrows and math operators)Unicode additions (arrows and math operators; math operators on default level)Unitek KB-1925Urdu (Pakistan)Urdu (Pakistan, CRULP)Urdu (Pakistan, NLA)Urdu (Win keys)Urdu (alt. phonetic)Urdu (phonetic)Use keyboard LED to indicate modifiersUse keyboard LED to show alternative layoutUsing space key to input non-breaking spaceUsual space at any levelUyghurUzbekUzbek (Afghanistan)Uzbek (Afghanistan, OLPC)Uzbek (Latin)VietnameseVietnamese (AÐERTY)Vietnamese (French, with Vietnamese letters)Vietnamese (QĐERTY)Vietnamese (US, with Vietnamese letters)ViewSonic KU-306 InternetWang 724 keypad with Unicode additions (arrows and math operators)Wang 724 keypad with Unicode additions (arrows and math operators; math operators on default level)Win is mapped to PrtSc and the usual WinWin+SpaceWinbook Model XP5WolofYahoo! InternetYakutYorubaZero-width non-joiner at the 2nd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, nothing at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, thin non-breaking space at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, zero-width joiner at the 4th levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd level, non-breaking space at the 4th levelZero-width non-joiner at the 3rd level, zero-width joiner at the 4th levelakamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcsdadede_llddlgdvdzeMachines m6800 laptopeeeneoeseteufafffifofrfr-tggaagaggrguhahehihrhuhyidieigikeinisitit_lldjajvkakikkkmknkokukutlaloltlvmdmimkmlmnmrmsmtmynenlnooldhunorpaphplpsptrorusasatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzhProject-Id-Version: xkeyboard-config-2.37.99
Report-Msgid-Bugs-To: 
PO-Revision-Date: 2024-04-14 10:00+0000
Last-Translator: fdillanes <Unknown>
Language-Team: Spanish <[email protected]>
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
X-Launchpad-Export-Date: 2025-04-10 21:27+0000
X-Generator: Launchpad (build e76edd883483c71c468bb038e98836435de44530)
Language: es
X-Bugs: Report translation errors to the Language-Team address.
&lt;Menor que/Mayor que&gt;&lt;Menor que/Mayor que&gt; elige el 5º nivel, bloquea al pulsarse junto con otro selector de 5º nivel&lt;Menor que/Mayor que&gt;;  actúa como bloqueo de una sola vez al pulsarse junto con otro selector de 3º nivel3er nivel de &lt;Menor que/Mayor que&gt;3er nivel de tecla Bloq Mayús3er nivel de Ctrl izquierdo3er nivel de tecla windows izquierda3er nivel de tecla Menu3er nivel de Control derecho3er nivel de tecla windows derechaA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLSímbolos de teclado APL: APLX unificado, distribución APLSímbolos de teclado APL: IBM APL2Símbolos de teclado APL: Manugistics APL*PLUS IISímbolos de teclado APL: Distibucion unificadaSímbolos de teclado APL: saxEstilo de cajero automático ó teléfonoAcer AirKey VAcer C300Acer Ferrari 4000Portátil AcerAñadir el comportamiento estándar a la tecla MenúAñadir las tildes del esperantoAñadir símbolo de divisa a algunas teclasAdvance Scorpius KIAfganoAkanAlbanésAlbanés (Plisi)Albanés (Veqilharxhi)Permitir tomar interrupciones con el teclado (Peligro: riesgos de seguridad)Permitir tomar y loguearse al servidor windowsAlt y Meta están en las teclas AltAlt está mapeada a la tecla Windows derecho y Super a la tecla MenúAlt está mapeada en las teclas Windows (y las teclas Alt usuales)Alt está cambiado con la tecla WindowsAlt+Bloq MayúsAlt+CtrlAlt+MayúsAlt+EspacioComportamiento de la tecla Alt/WindowsAmharicoCualquier tecla AltCualquier tecla WindowsCualquier tecla Windows (al pulsarla)AppleTeclado de aluminio de Apple (ANSI)Teclado de aluminio de Apple (ISO)Teclado de aluminio de Apple (JIS)Teclado de aluminio de Apple: emular teclas PC (Imprimir pantalla, Bloq Despl, Pausa, Bloq Num)Portátil AppleÁrabeÁrabe (AZERTY)Árabe (AZERTY/dígitos)Árabe (Argelia)Árabe (Buckwalter)Árabe (Macintosh)Árabbe (Marruecos)Árabe (OLPC)Árabe (Pakistán)Árabe (QWERTY)Árabe (Sun tipo 6/7)Árabe (Siria)Árabe (dígitos)Árabe (qwerty/dígitos)Árabe (con extensiones para otros lenguajes de escritura árabe y dígitos arábigos)Árabe (con extensiones para otros lenguajes de escritura árabe y dígitos europeos)ArmenioArmenio (OLPC fonético)Armenio (oriental alternativo)Armenio (fonético alternativo)Armenio (oriental)Armenio (fonético)Armenio (occidental)Asturiano (España, con H y L con punto bajo)Portátil AsusEn la parte inferior izquierdaA la izquierda de la «A»AtsinaAvatimeAvésticoAzerbaijaníAzerbajaní (cirílico)Inálambrico Internet Azona RF2300BTC 5090BTC 5113RF MultimediaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UInalámbrico Internet y Juegos BTC 9116U MiniContrabarraContrabarra actúa como un bloqueo de una sola vez al pulsarse junto con otro selector de tercer nivelBambaraBangladeshBengalí (India)Bengalí (India, Inscript Baishakhi)Bengalí (India, Baishakhi)Bengalí (India, Bornona)Bengalí (India, Probhat)Bengalí (India, Uni Gitanjali)Bengalí (Probhat)BaskirioBielorrusoBielorruso (latino)Bielorruso (arcaico)BelgaBelga (Sun tipo 6/7)Belga (modelo AZERTY 724 de Wang)Belga (ISO alternativo)Belga (alternativo)Belga (alternativo, sólo latin-9)Belga (teclas muertas de Sun)Belga (sin teclas muertas)Belga (teclas muertas de Sun)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Bereber (Argelia, Latin)Bereber (Marruecos, tifinagh)Bereber (Marruecos, tifinagh alternativo fonético)Bereber (Marruecos, tifinagh alternativo)Bereber (Marruecos, tifinagh fonético extendido)Bereber (Marruecos, tifinagh extendido)Bereber (Marruecos, tifinagh fonético)Bereber (Marruecos, tifinagh)BosnioBosnio (con dígrafos bosnios)Bosnio (teclado de EE. UU. con letras bosnias)Bosnio (con dígrafos bosnios)Bosnio (con guillemets)Ambas teclas Alt juntasAmbas teclas Ctrl juntasAmbas teclas Mayús juntasAmbas teclas Mayús juntas conmutan Bloq MayúsAmbas teclas Mayús juntas conmutan Bloq Mayús, una tecla Mayús lo desactivaAmbas teclas Mayús juntas conmutan Bloq MayúsBrailleBraille (pulgar izquierdo  invertido)Braille (zurdo)Braille (pulgar derecho invertido)Braille (diestro)Brother InternetBúlgaroBúlgaro (fonética nueva)Búlgaro (fonética tradicional)BirmanoBirmano ZawgyiCamerunés multilingüe (AZERTY)Camerunés multilingüe (Dvorak)Camerunés multilingüe (QWERTY)Canadiense multilingüeCanadiense multilingüe (primera parte)Canadiense multilingüe (segunda parte)Bloqueo de mayúsculasBloq Mayús (al pulsarse), Alt+Bloq Mayús realiza la acción original de bloqueo de mayúsculasBloq Mayús actúa como Mayús con bloqueo; Mayús «pausa» Bloq MayúsBloq Mayús actúa como Mayús con bloqueo; Mayús no afecta a Bloq MayúsBloq Mayús como CtrlComportamiento de Bloq MayúsBloq Mayús es también CtrlBloq Mayús está desactivadoBloq Mayús (a la primera distribución), Mayús+Bloq Mayús (a la última distribución)Bloq Mayús cambia Mayús de forma que todas las teclas están afectadasBloq Mayús cambia la capitalización normal de los caracteres alfabéticosBloq Mayús usa la capitalización interna; Mayús «pausa» el Bloq MayúsBloq Mayús usa la capitalización interna; Mayús no afecta a Bloq MayúsBloq Mayús actúa como un bloqueo de una sola vez al pulsarse junto con cualquier otro selector de tercer nivelCatalán (España, con L con punto medio)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@rdCherry Blue Line CyBo@rdCherry CyBo@rd USB-HubCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony InternetChicony KB-9885Chicony KU-0108Chicony KU-0420ChinoChromebookEslavo eclesiásticoChuvashCuvash (latino)Classmate PCCló GaelachCœur d’Alene SalishPortátil Compaq ArmadaCompaq Easy AccessCompaq Internet (13 teclas)Compaq Internet (18 teclas)Compaq Internet (7 teclas)Portatil Compaq PresarioTeclado Compaq iPaqComponerCreative Desktop Wireless 7000Tártaro de Crimea (Dobruca Q)Tártaro de Crimea (Alt-Q turca)Tártaro de Crimea (F turca)Tártaro de Crimea (Q turca)CroataCroata (con dígrafos croatas)Croata (EE. UU. con letras croatas)Croata (con dígrafos croatas)Croata (con guillemets)Control está mapeada en las teclas Alt, Alt está mapeado en las teclas WindowsControl está mapeada en las teclas Windows (y las teclas Ctrl usuales)Posición de la tecla CtrlControl + Alt + RetrocesoCtrl+MayúsChecoCheco (QWERTY)Checo (QWERTY, Macintosh)Checo (QWERTY, contrabarra extendida)Checo (Sun tipo 6/7)Checo (UCW, sólo teclas con tilde)Checo (Dvorak EE. UU. con soporte UCW checo)Checo (codificador)Checo (Programador)Checo (programador, tipográfico)Checo (tipográfico)Checo (con tecla «\|»)Checo Eslovaco y Alemán (EE.UU)DTK2000DanésDanés (Dvorak)Danés (Macintosh)Danés (Macintosh, sin teclas muertas)Danés (Sun tipo 6/7)Danés (teclas Windows)Danés (sin teclas muertas)Teclas del teclado numérico predeterminadoDellDell PC 101 teclasPortátil Dell Inspiron 6000/8000Portátil Dell LatitudePortátil Dell Precision MPortátil Dell Precision M65Dell SK-8125Dell SK-8135Dell USB MultimediaInalámbrico Dexxa DesktopDhivehiDiamond 9801 / 9802HolandésHolandés (Macintosh)Holandés (Sun tipo 6/7)Holandés (estándar)Holandés (teclas muertas de Sun)Dyalog APL completoDzongkhaElfdaliano (Sueco, con ogònec combinado)Activar caracteres tipográficos adicionalesInglés (3l)Inglés (Australiano)Inglés (Camerún)Inglés (Canadá)Inglés (Carpalx)Inglés (Carpalx, optimizaciòn completa)Inglés (Carpalx, optimizaciòn completa, internacional con teclas muertas por AltGr)Inglés (Carpalx, optimizaciòn completa, internacional con teclas muertas)Inglés (Carpalx, internacional con teclas muertas por AltGr)Inglés (Carpalx, internacional con teclas muertas)Inglés (Colemak)Inglés (Drix)Inglés (Dvorak)Inglés (Dvorak,internacional alternativo)Inglés (Dvorak, internacional con teclas muertas)Inglés (Dvorak, para zurdos)Inglés (Dvorak para diestros)Inglés (Ghana)Inglés (Ghana, GILLBT)Inglés (Ghana, multilingüe)Inglés (India, con signo de rupia)Inglés (Macintosh)Inglés (Mali, Macintosh de EE. UU.)Inglés (Malí, EE. UU. internacional)Inglés (Nigeria)Inglés (Norman)Inglés (Sudáfrica)Inglés (RU)Inglés (RU, Colemak)Inglés (RU, Dvorak)Inglés (RU, Dvorak con puntuación para RU)Inglés (RU, Macintosh)Inglés (UK, Sun tipo 6/7)Inglés (RU, extendido con teclas Windows)Inglés (RU, Macintosh)Inglés (RU, internacional con teclas muertas)Inglés (EE. UU.)Inglés (EEUU. IBM árabe 238_L)Inglés (EE. UU, Sun tipo 6/7)Inglés (EE. UU, internacional alternativo)Inglés (EE. UU. con euro en el 5)Inglés (EE. UU., internacional combinando Unicode por AltGr)Inglés (EE. UU., internacional combinando Unicode por AltGr, alternativo)Inglés (EE. UU. internacional con teclas muertas)Inglés (Workman)Inglés (Workman, internacional con teclas muertas)Inglés (Dvorak clásico)Inglés (internacional con teclas muertas por AltGr)Inglés (Dvorak de programador)Inglés (las teclas dividir/multiplicar cambian la distribución)Ennyah DKB-1008Intro en el teclado numéricoEsperantoEsperanto (Brasil, Nativo)Esperanto (Portugal, Nativo)Estonio (punto y coma y comilla desplazadas, obsoleto)EstonioEstonio (Dvorak)Estonio (Sun tipo 6/7)Estonio (EE. UU. con letras estonias)Estonio (sin teclas muertas)EurKEY (teclado de distribución estadounidense con letras europeas)Euro en el 2Euro en el 4Euro en el 5Euro en la EEverex STEPnoteEweFL90FaroésFaroés (sin teclas muertas)FilipinoFilipino (Capewell-Dvorak, Baybayin)Filipino (Capewell-Dvorak, latino)Filipino (Capewell-QWERF 2006, Baybayin)Filipino (Capewell-QWERF 2006, latino)Filipino (Colemak baybayin)Filipino (Colemak latino)Filipino (Dvorak baybayin)Filipino (Dvorak latino)Filipino (QWERTY, Baybayin)FinésFinlandés (DAS)Finlandés (Dvorak)Finlandés (Macintosh)Finlandés (Sun tipo 6/7)Finlandés (teclas Windows)Finés (clásico)Finlandés (clásico, sin teclas muertas)Tecla de cuarto nivel con separadores abstractosTecla de cuarto nivel con comaTecla de cuarto nivel con puntoTecla de cuarto nivel con punto, restricción latin-9Tecla de cuarto nivel con momayyezFrancésFrancés (AZERTY)Francés (bepo, ergonómico, forma Dvorak)Francés (bepo, ergonómico, forma Dvorak, sólo latin-9)Francés (bretón)Francés (Camerún)Francés (Canadá)Francés (Canadá, Dvorak)Francés (Canadá, arcaico)Francés (República Democrática del Congo)Francés (Dvorak)Francés (Guinea)Francés (Macintosh)Francés (Mali, alternativo)Francés (Marruecos)Francés (Sun tipo 6/7)Francés (Suizo)Francés (Suizo, Macintosh)Francés (Suiza, Sun tipo 6/7)Francés (Suizo, sin teclas muertas)Francés (Suizo, teclas muertas de Sun)Francés (Togo)Francés (EE.UU., AZERTY)Frances (teclado estadounidense con letras Francesas)Francés (EE.UU. con teclas francesas y muertas, alternativo)Francés (alternativo)Francés (alternativo, sólo latin-9)Francés (alternativo, sin teclas muertas)Francés (alternativo, teclas muertas de Sun)Francés (arcaico, alternativo)Francés (arcaico, alternativo, sin teclas muertas)Francés (arcaico, alternativo, teclas muertas de Sun)Francés (sin teclas muertas)Francés (teclas muertas de Sun)Friulano (Italia)Portátil Fujitsu-Siemens AmiloFulaGaPC genérico 101 teclasPC genérico 102 teclas(intl.)PC genérico 104 teclasPC genérico 105 teclas (intl)Genius Comfy KB-12eGenius Comfy KB-16M / Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGeorgianoGeorgiano (Francia, AZERTY tskapo)Georgiano (Italia)Georgiano (MESS)Georgiano (ergonómico)AlemánAlemán (Aus der Neo-Welt)Alemán (Austria)Alemán (Austria, Macintosh)Alemán (Austria, sin teclas muertas)Alemán (Austria, teclas muertas de Sun)Alemán (Bone)Alemán (Bone, eszett en linea de inicio)Alemán (Dvorak)Alemán (KOY)Alemán (Macintosh)Alemán (Macintosh, sin teclas muertas)Alemán (Neo 2)Alemán (Neo QWERTY)Alemán (Neo QWERTZ)Alemán (QWERTY)Alemán (Sun tipo 6/7)Alemán (Suizo)Alemán (Suizo, Macintosh)Alemán (Suiza, Sun tipo 6/7)Alemán (Suizo, arcaico)Alemán (Suizo, sin teclas muertas)Alemán (Suizo, teclas muertas de Sun)Alemán (T3)Alemán (teclado estadounidense con letras alemanas)Alemán (acento muerto)Alemán (acento grave muerto)Alemán (acento muerto)Alemán (sin teclas muertas)Alemán (con letras húngaras y sin teclas muertas)Alemán (teclas muertas de Sun)Alemán LadinoAlemán, Sueco y Finlandés (EEUU)GriegoGriego (Colemak)Griego (Sun tipo 6/7)Griego (extendido)Griego (sin teclas muertas)Griego (politónico)Griego (simple)GujaratiGyrationHanyu Pinyin (altgr)Happy HackingHappy Hacking para MacHausa (Ghana)Hausa (Nigeria)HebreoHebreo (bíblico, fonética SIL)Hebreo (bíblico, tiro)Hebreo (lyx)Hebreo (fonético)Hewlett-Packard InternetPortátil Hewlett-Packard Mini 110Hewlett-Packard SK-250x MultimediaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020HexadecimalHindi (bolnagri)Hindi (fonético KaGaPa)Hindi (Wx)Honeywell EuroboardHúngaroHúngaro (101/QWERTY/coma/teclas muertas)Húngaro (101/QWERTY/coma/sin teclas muertas)Húngaro (101/QWERTY/punto/teclas muertas)Húngaro (101/QWERTY/punto/sin teclas muertas)Húngaro (101/QWERTZ/coma/teclas muertas)Húngaro (101/QWERTZ/coma/sin teclas muertas)Húngaro (101/QWERTZ/punto/teclas muertas)Húngaro (101/QWERTZ/punto/sin teclas muertas)Húngaro (102/QWERTY/coma/teclas muertas)Húngaro (102/QWERTY/coma/sin teclas muertas)Húngaro (102/QWERTY/punto/teclas muertas)Húngaro (102/QWERTY/punto/sin teclas muertas)Húngaro (102/QWERTZ/coma/teclas muertas)Húngaro (102/QWERTZ/coma/sin teclas muertas)Húngaro (102/QWERTZ/punto/teclas muertas)Húngaro (102/QWERTZ/punto/sin teclas muertas)Húngaro (QWERTY)Húngaro (sin teclas muertas)Húngaro (estándar)Hyper está mapeada a las teclas WindowsIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIslandésIslandés (Dvorak)Islandés (Macintosh)Islandés (Macintosh, arcaico)Islandés (sin teclas muertas)Islandés (teclas muertas de Sun)IgboIndioIndonés (Arabe malayo, fonético)Indonés (Javanés)Alfabeto fonético internacionalInuktitutIraquíIrlandésIrlandés (UnicodeExperto)ItalianoItaliano (IBM 142)Italiano (Macintosh)Italiano (Sun tipo 6/7)Italiano (EE. UU. con letras italianas)Italiano (teclas Windows)Italiano (Internacional,  teclas muertas)Italiano (sin teclas muertas)Ladino italianoJaponesJaponés (Dvorak)Japonés (kana 86)Japonés (kana)Japonés (Macintosh)Japonés (OADG 109A)Japonés (series PC-98)Japonés (Sun tipo 6)Japonés (Sun tipo 7 - compatible con PC)Japonés (Sun tipo 7 - compatible con Sun)Opciones de teclado japonésCalmucoLa tecla Bloq Kana está bloqueandoKannadaCanarés (fonético KaGaPa)CasubioKazajoKazajo (latino)Kazajo (extendido)Kazajo (con ruso)Secuencia de teclas para matar el servidor XTecla para seleccionar el 5.º nivelTecla para seleccionar el tercer nivelKeytronic FlexProKhmer (Camboya)KikuyuKinesisKomiCoreanoCoreano (101/104 teclas compatible)Coreano (Sun tipo 6/7)Hangul koreano/ teclas HanjaKurdo (Irán, arábigolatino)Kurdo (Irán, F)Kurdo (Irán, latino Alt-Q)Kurdo (Irán latino Q)Kurdo (Irak, arábigolatino)Kurdo (Irak, F)Kurdo (Irak, latino Alt-Q)Kurdo (Irak, latino Q)Kurdo (Siria, F)Kurdo (Siria, latino Alt-Q)Kurdo (Siria, latino Q)Kurdo (Turquía, F)Kurdo (Turquía, latino Alt-Q)Kurdo (Turquía, latino Q)KutenaiKirguíKirguí (fonético)LaoLao (distribución propuesta STEA estándar)LetónLetón (F)Letón (Sun tipo 6/7)Letón (Colemak EE.UU.)Letón (Colemak EE.UU., variante con apóstrofo)Letón (Dvorak de EE. UU.)Letón (Dvorak de EE. UU., variante Y)Letón (Dvorak de EE. UU., variante menos)Letón (adaptado)Letón (apóstrofo)Letón (ergonómico, ŪGJRMV)Letón (moderno)Letón (programador, Dvorak de EE. UU.)Letón (programador, Dvorak de EE. UU., variante Y)Letón (programador, Dvorak de EE. UU., variante menos)Letón (tilde)Distribución del teclado numéricoAlt izquierdoAlt izquierda (mientras está pulsada)Tecla Alt izquierda como tecla Ctrl, Tecla Ctrl izquierda como tecla Windows, tecla Windows izquierda como tecla Alt izquierdaAlt izquierdo está cambiado con la tecla Windows izquierdaAlt izquierdo + Mayús izquierdoCtrl izquierdaCtrl izquierdo como MetaCtrl izquierdo (a la primera distribución), Ctrl derecho (a la última distribución)Ctrl izquierdo + Mayús izquierdoCtrl izquierdo + tecla windows izquierdaCtrl izquierdo + Tecla Win izquierda (a la primera distribución), Ctrl derecho + Menú (a la segunda distribución)Mayús izquierdoWin izquierdoTecla Windows izquierda (mientras está pulsarda)Tecla Win izquierda elige el 5º nivel, bloquea al pulsarse junto con otro selector de 5º nivelWin izquierdo (a la primera distribución), Win/Menu derecho (a la última distribución)ArcaicoWang 724 arcaicoTecla arcaica con comaTecla arcaica con puntoLituanoLituano (IBM LST 1205-92)Lituano (LEKP)Lituano (LEKPa)Lituano (Sun tipo 6/7)Lituano (Dvorak de EE. UU. con letras lituanas)Lituano (EE. UU. con letras lituanas)Lituano (estándar)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (alt.)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (alternativa 2)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorLogitech G15 con teclas extra a través de G15daemonLogitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless (modelo Y-RB6)Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE (USB)Bajo soraboBajo sorabo (QWERTZ)MacBook/MacBook ProMacBook/MacBook Pro (intl.)MacedonioMacedonio (sin teclas muertas)MacintoshMacintosh antiguoMantener compatibilidad de teclas con los viejos códigos de SolarisHacer de Bloq Mayús un Retroceso adicionalHacer de Bloq Mayús un Esc adicionalHacer de Bloq Mayús un Hyper adicionalHacer de Bloq Mayús una tecla Menu adicionalHacer de Bloq Mayús un Bloq Num adicionalHacer de Bloq Mayús un Super adicionalHacer de Zenkaku Hankaku un Esc adicionalHacer del Alt derecho una tecla hangulHacer del Alt derecho una tecla hanjaHacer del Ctrl derecho una tecla hangulHacer del Ctrl derecho una tecla hanjaConvertir Bloq Mayús (sin modificar) en otra Esc, pero que Mayús + Bloq Mayús se comporte como un Bloq Mayús normalMalayo (Jawi, Teclado Arábigo)Malayo (fonético)MalayalamMalayalam (lalitha)Malayalam (Inscript mejorado con signo de rupia)MaltésMaltés (con distribución para EE. UU.)Manipuri (Eeyek)MaoríMaratí (fonético KaGaPa)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenúMenu (al pulsarla), Mayus+Menu para MenuMenú como Ctrl derechoMeta está mapeada a las teclas WindowsMeta está mapeada a la tecla Windows izquierdoMeta está mapeada a las teclas WindowsMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro, suecoMicrosoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB / Microsoft Internet ProMicrosoft Natural Pro OEMMicrosoft Natural Wireless Ergonomic 7000Teclado Microsoft OfficeMicrosoft SurfaceInalámbrico Multimedia Microsoft 1.0AOpciones misceláneas de compatiblidadMmuockMoldavoMoldavo (Gagauzia)MongolMongol (Bichig)MontenegrinoMontenegrino (cirílico con guillemots)Montenegrino (cirílico)Montenegrino (cirílico, ZE y ZHE intercambiados)Montenegrino (latino con guillemots)Montenegrino (latino QWERTY)Montenegrino (latino Unicode)Montenegrino (latino Unicode, QWERTY)Multilingüe (Canada, Sun tipo 6/7)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100Retroceso estilo NICOLA-FNepalíCarácter de espacio no separable en el segundo nivelCarácter de espacio no separable en el tercer nivelCarácter de espacio no separable en el tercer nivel, nada en el cuarto nivelCarácter de espacio no separable en el tercer nivel, carácter de espacio estrecho no separable en el cuarto nivelCarácter de espacio no separable en el cuarto nivelCarácter de espacio no separable en el cuarto nivel, carácter de espacio estrecho no separable en el sexto nivelCarácter de espacio no separable en el cuarto nivel, carácter de espacio estrecho no separable en el sexto nivel (a través de Ctrl+Mayús)Lapón del norte (Finlandia)Lapón del norte (Noruega)Lapón del norte (Noruego, sin teclas muertas)Lapón del norte (Suecia)Northgate OmniKey 101NoruegoNoruego (Colemak)Noruego (Dvorak)Noruego (Macintosh)Noruego (Macintosh, sin teclas muertas)Noruego (Sun tipo 6/7)Noruego (teclas Windows)Noruego (sin teclas muertas)Bloq NúmBloq Num encendido: dígitos, Mayús cambia a teclas con flecha, Block Num apagado: siempre teclas con flecha (como en MS Windows)La tecla número 4 cuando es presionada solaLa tecla número 9 cuando es presionada solaComportamiento de la tecla Supr del teclado numéricoLas teclas del teclado numérico siempre introducen dígitos (como en Mac OS)OLPCOccitanoOghamOgam (IS434)Ol ChikiAntigüo HúngaroOriyaOrtek Multimedia/Internet MCK-800Osetio (Georgia)Osetio (teclas Windows)Osetio (arcaico)PC-98Rusino de PanoniaPosición de los parentesisPashtoPashto (Afganistán, OLPC)PausaPersaPersa (Afganistán, OLPC dari)Persa (con teclado numérico persa)PolacoPolaco (teclado británico)Polaco (Colemak)Polaco (Dvorak)Polaco (Dvorak, comillas polacas en la tecla 1)Polaco (Dvorak, comillas polacas en la tecla de comillas)Rumano (Alemán, teclas muertas eliminadas)Polaco (glagolítico)Polaco (QWERTZ)Polaco (Sun tipo 6/7)Polaco (internacional con teclas muertas)Polaco (arcaico)Polaco (Dvorak de programador)PortuguésPortugués (Brasil)Portugués (Brasil, Dvorak)Portugués (Brasil, IBM/Lenovo ThinkPad)Portugués (Brasil, Nativo para teclados de EE. UU.)Portugués (Brasil, Nativo)Portugués (Brasil, Sun tipo 6/7)Portugués (Brasil, sin teclas muertas)Portugués (Colemak)Portugués (Macintosh)Portugués (Macintosh, sin teclas muertas)Portugués (Macintosh, teclas muertas de Sun)Portugués (Nativo para teclados de EE. UU.)Portugués (Nativo)Portugués (Sun tipo 6/7)Portugués (sin teclas muertas)Portugués (teclas muertas de Sun)Posición de la tecla ComponerPropeller Voyager KTEZ-1000ImpPntPanyabí (gurmukhi jhelum)Panyabí (gurmukhi)QTronix Scorpius 98N+Alt derechoAlt derecha (mientras está pulsada)La tecla Alt derecho elige el quinto nivelAlt derecho elige el 5º nivel, bloquea al pulsarse junto con otro selector de 5º nivelLa tecla Alt derecho nunca elige el tercer nivelLa tecla Alt derecho, Mayús+Alt derecho es tecla ComponerCtrl derechoCtrl derecho (mientras está pulsado)Ctrl derecho como Alt derechoCtrl derecho + Mayús derechoMayús derechoWindows derechoLa tecla Windows (mientras está pulsada)Tecla Win derecha elige el 5º nivel, bloquea al pulsarse junto con otro selector de 5º nivelRumanoRumano (Alemania)Rumano (Alemania, sin teclas muertas)Rumano (Sun tipo 6/7)Rumano (teclas Windows)Rumano (cedilla)Rumanía (tipo de pulsación ergonómica)Rumano (cedilla estándar)Rumano (estándar)Rupia en el 4RusoRuso (Checo, fonético)Ruso (DOS)Ruso (Georgia)Ruso (Alemania, fonético)Ruso (Alemán, recomendado)Ruso (Alemania, transliterado)Ruso (Kazajstán, con kazajo)Ruso (Macintosh)Ruso (Polonia, Dvorak fonético)Ruso (Políglota y Reaccionario)Ruso (Rulemak, Colemak fonético)Ruso (Sun tipo 6/7)Ruso (sueco, fonético)Ruso (sueco, fonético, sin teclas muertas)Ruso (EE. UU., fonético)Ruso (ucraniano estándar RSTU)Ruso (arcaico)Ruso (Macintosh fonético)Ruso (fonético azerty)Ruso (fonético)Ruso (fonético, AZERTY)Ruso (fonético, Dvorak )Ruso (fonético, francés)Ruso (fonético, con teclas Windows)Ruso (máquina de escribir)Ruso (máquina de escribir, arcaico)Ruso (con puntuacion americana)Ruso (con distribución ucraniana y bielorrusa)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taiwán)SamogitioSamsung SDM 4500PSamsung SDM 4510PSánscrito (fonético KaGaPa)Sanwa Supply SKB-KG3Bloq DesplShuswapPunto y coma en tercer nivelSerbioSerbio (cirílico con guillemots)Serbio (cirílico, ZE y ZHE intercambiados)Serbio (latino con guillemots)Serbio (latino)Serbio (latino, QWERTY)Serbio (latino Unicode)Serbio (latino Unicode, QWERTY)Serbio (Rusia)Serbio (combinar tildes en lugar de teclas muertas)Serbocroata (EE. UU.)Shift + Bloq Num habilita las teclas de flechasMayús cancela Bloq MayúsMayús no cancela Bloq Num, en su lugar elije el 3er nivelMayús+Bloq MayúsSicilianoSiciliano (Teclado EE UU)SilesianoInalámbrico Multimedia SilvercrestSindhiCingalés (EE. UU. con letras cingalesas)Cingalés (fonético)EslovacoEslovaco (Distribución ACC, sólo teclas con tilde)Eslovaco (QWERTY)Eslovaco (QWERTY, contrabarra extendida)Eslovaco (Sun tipo 6/7)Eslovaco (contrabarra extendida)EslovenoEsloveno (EE. UU. con letras eslovenas)Esloveno (con guillemets)EspañolEspañol (Dvorak)Español (latinoamericano)Español (latinoamericano, Colemak para juegos)Español (latinoamericano, Colemak)Español (latinoamericano, Dvorak)Español (latinoamericano, incluye tilde muerta)Español (latinoamericano, sin teclas muertas)Español (latinoamericano, con teclas muertas de Sun)Español (Macintosh)Español (Sun tipo 6/7)Español (teclas Windows)Español (tilde muerta)Español (sin teclas muertas)Español (teclas muertas de Sun)Teclas especiales (Ctrl+Alt+«tecla») manipuladas en un servidorSerie Acero Apex 300Compatibilidad con tecla SunSun tipo 6 (Distribución Japonesa)Sun tipo 6 USB (Distribución Japonesa)Sun tipo 6 USB (Distribución Unix)Sun tipo 6/7 USBSun tipo 6/7 USB (Distribución Europea)Sun tipo 7 USBSun tipo 7 USB (Distribución Europea)Sun tipo 7 USB (Distribución Japonesa) / Japonés 106 teclasSun tipo 7 USB (Distribución Unix)Super Power MultimediaSwahili (Kenia)Swahili (Tanzania)Intercambiar Ctrl y Bloq MayúsIntercambiar ESC y Bloq MayúsIntercambiar tecla Alt Izquierda con tecla Ctrl IzquierdaIntercambiar tecla Windows Izquierda con tecla Ctrl IzquierdaIntercambiar tecla Windows Derecha con tecla Ctrl DerechaCambiar por parentesis cuadradosSuecoSueco (Dvorak A5)Sueco (Dvorak)Sueco (Macintosh)Sueco (Sun tipo 6/7)Sueco (Svdvorak)Sueco (EE. UU. con letras suecas)Sueco (Basado en EE.UU. internacional Dvorak)Sueco (sin teclas muertas)Lenguaje de signos suecoCambiar a otra distribuciónTablet Symplon PaceBookSirioSirio (fonético)TaiwanésTaiwanés (autóctono)TajicoTajico (arcaico)Tamil (Inscript)Tamil (Sri Lanka, Tamilnet ' 99)Tamil (Tamilnet ' 99, codificación de tabulación)Tamil (Tamilnet ' 99 con números del Tamil)Tamil (TamilNet '99)Tamil (Tamilnet ' 99, codificación de tabulación)Tamil (Tamilnet ' 99, codificación TSCII)Targa Visionary 811TatarTeluguTelugu (fonético KaPaGa)Telugu (Sarala)TailandésTailandés (Pattachote)Tailandés (TIS-820.2538)TibetanoTibetano (con numerales ASCII)A la tecla correspondiente en un teclado ColemakA la tecla correspondiente en un teclado DvorakA la tecla correspondiente en un teclado QwertyToshiba Satellite S3000Verdaderamente Ergonómico 227Verdaderamente Ergonómico 229Teclado Ergonómico modelo 227 (tecla Alt ancha)Teclado Ergonómico modelo 229 (teclas Alt de tamaño standar, con teclas Super y Menu adicionales)Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurcoTurco (Alt-Q)Turco (F)Turco (Alemania)Turco (Sun tipo 6/7)Turco (internacional con teclas muertas)Turco (teclas muertas de Sun)TurkmenistanoTurkmenistano (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (102/105:modo EU)TypeMatrix EZ-Reach 2030 USB (106:modo JP)UdmurtoUgarítico en lugar de ArábicoUcranianoUcraniano (Sun tipo 6/7)Ucraniano (teclas Windows)Ucraniano (homofónico)Ucraniano (arcaico)Ucraniano (fonético)Ucraniano (estándar RSTU)Ucraniano (máquina de escribir)Adiciones Unicode (flechas y operadores matemáticos)Adiciones Unicode (flechas y operadores matemáticos; operadores matemáticos en el nivel predeterminado)Unitek KB-1925Urdu (Pakistán)Urdu (Pakistán, CRULP)Urdu (Pakistán, NLA)Urdu (teclas Windows)Urdu (fonético alternativo)Urdu (fonético)Usar LED del teclado para mostrar la distribución alternativaUsar LED del teclado para mostrar la distribución alternativaUsar la tecla espacio para introducir un carácter de espacio no separableEspacio usual en cualquier nivelUigurUzbecoUzbeco (Afganistán)Uzbeco (Afganistán, OLPC)Uzbeco (latino)VietnamitaVietnamita (AÐERTY)Vietnamita  (Frances con letras vietnamitas)Vietnamita (QĐERTY)Vietnamita (EE. UU. con letras vietnamitas)ViewSonic KU-306 InternetTeclado numérico Wang 724 con adiciones Unicode (flechas y operadores matemáticos)Teclado numérico Wang 724 con adiciones Unicode (flechas y operadores matemáticos; operadores matemáticos en el nivel predeterminado)Tecla Windows está mapeada en la tecla Imprimir Pantalla y  las teclas Windows usualesTecla Windows + espaciadoraWinbook Model XP5WolofYahoo! InternetYakutoYorubaCarácer de espacio irrompible de anchura cero («ZWNJ») en el segundo nivelCarácer de espacio irrompible de anchura cero («ZWNJ») en el segundo nivel, carácter de espacio no separable en el tercer nivelCarácer de espacio irrompible de anchura cero («ZWNJ») en el segundo nivel, carácter de espacio no separable en el tercer nivel, nada en el cuarto nivelCarácer de espacio irrompible de anchura cero («ZWNJ») en el segundo nivel, carácter de espacio no separable en el tercer nivel, espacio estrecho no separable en el cuarto nivelCarácer de espacio irrompible de anchura cero («ZWNJ») en el segundo nivel, carácter de espacio no separable en el tercer nivel, espacio de anchura cero («ZWJ») en el cuarto nivelCarácer de espacio irrompible de anchura cero («ZWNJ») en el segundo nivel, carácter de anchura cero («ZWJ») en el tercer nivelCarácer de espacio irrompible de anchura cero («ZWNJ») en el segundo nivel, carácter de espacio de anchura cero («ZWJ») en el tercer nivel, caracter de espacio no separable en el cuarto nivelCarácer de espacio irrompible de anchura cero («ZWNJ») en el tercer nivel, carácter de anchura cero («ZWJ») en el cuarto nivelakamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcsdadede_llddlgdvdzportátil eMachines m6800eeeneoeseteufafffifofrfr-tggaagaggrguhahehihrhuhyidieigikeinisitit_lldjajvkakikkkmknkokukutlaloltlvmdmimkmlmnmrmsmtmynenlnooldhunorpaphplpsptrorusasatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzh

Filemanager

Name Type Size Permission Actions
Linux-PAM.mo File 9.91 KB 0644
ModemManager.mo File 3.25 KB 0644
NetworkManager-openvpn.mo File 36.07 KB 0644
NetworkManager-pptp.mo File 10.36 KB 0644
NetworkManager.mo File 290.63 KB 0644
PackageKit.mo File 30.7 KB 0644
WebKitGTK-6.0.mo File 25.86 KB 0644
aa-enabled.mo File 1.36 KB 0644
accounts-service.mo File 1.87 KB 0644
acl.mo File 7.25 KB 0644
adduser.mo File 9.76 KB 0644
aisleriot.mo File 48.06 KB 0644
alacarte.mo File 1.68 KB 0644
alsa-utils.mo File 27.53 KB 0644
alternative-toolbar.mo File 5.54 KB 0644
app-install-data.mo File 445.63 KB 0644
apparmor-parser.mo File 17.98 KB 0644
apparmor-utils.mo File 13.24 KB 0644
apparmorapplet.mo File 1.27 KB 0644
apport.mo File 28.35 KB 0644
appstream-glib.mo File 8.81 KB 0644
appstream.mo File 113.32 KB 0644
apt-listchanges.mo File 7.94 KB 0644
apt-utils.mo File 10.68 KB 0644
apt.c.mo File 721 B 0644
apt.mo File 42.39 KB 0644
apt.sh.mo File 1.51 KB 0644
aptdaemon.mo File 29.54 KB 0644
aptitude.mo File 181 KB 0644
apturl.mo File 4.16 KB 0644
aspell.mo File 31.7 KB 0644
at-spi2-core.mo File 739 B 0644
attr.mo File 4.76 KB 0644
avahi.mo File 16.61 KB 0644
balsa.mo File 128.56 KB 0644
baobab.mo File 6.91 KB 0644
bash.mo File 180.34 KB 0644
bfd.mo File 146.87 KB 0644
bijiben.mo File 8.93 KB 0644
binutils.mo File 118.93 KB 0644
bison-gnulib.mo File 2.36 KB 0644
bison-runtime.mo File 1.37 KB 0644
bison.mo File 12.45 KB 0644
brltty.mo File 4.91 KB 0644
byobu.mo File 3.86 KB 0644
bzr.mo File 209.07 KB 0644
caribou.mo File 4.15 KB 0644
cheese.mo File 12.1 KB 0644
cinder.mo File 332 KB 0644
clutter-1.0.mo File 2.82 KB 0644
cluttergtk-1.0.mo File 551 B 0644
cogl.mo File 8.2 KB 0644
colord.mo File 9.6 KB 0644
command-not-found.mo File 3.88 KB 0644
coreutils.mo File 210.47 KB 0644
cpio.mo File 29.98 KB 0644
cracklib.mo File 1.95 KB 0644
cryptsetup-luks.mo File 6.43 KB 0644
cryptsetup.mo File 8.41 KB 0644
cups-pk-helper.mo File 3.43 KB 0644
cups.mo File 274.61 KB 0644
cwidget.mo File 1.41 KB 0644
dashtodock.mo File 13.84 KB 0644
dconf-editor.mo File 48.23 KB 0644
dctrl-tools.mo File 8.63 KB 0644
debconf.mo File 11.65 KB 0644
debian-tasks.mo File 952 B 0644
debianutils.mo File 2.06 KB 0644
deja-dup.mo File 36.81 KB 0644
desktop_kde-config-whoopsie.mo File 814 B 0644
desktop_kubuntu-driver-manager.mo File 705 B 0644
desktop_kubuntu-notification-helper.mo File 2.2 KB 0644
desktop_kubuntu-web-shortcuts.mo File 4.21 KB 0644
devhelp.mo File 8.57 KB 0644
devscripts.mo File 96.09 KB 0644
diffutils.mo File 36 KB 0644
ding.mo File 17.25 KB 0644
dnsmasq.mo File 30.85 KB 0644
doc-base.mo File 10.29 KB 0644
dpkg-dev.mo File 53.74 KB 0644
dpkg.mo File 126.13 KB 0644
dselect.mo File 40.76 KB 0644
duplicity.mo File 26.47 KB 0644
e2fsprogs.mo File 195.43 KB 0644
ecryptfs-utils.mo File 1.96 KB 0644
elfutils.mo File 138.66 KB 0644
eog-plugins.mo File 8.2 KB 0644
eog.mo File 30.57 KB 0644
epiphany.mo File 69.94 KB 0644
evince.mo File 37.02 KB 0644
evolution-data-server.mo File 1.18 KB 0644
evolution.mo File 537.77 KB 0644
example-content.mo File 584 B 0644
extension-manager.mo File 7.85 KB 0644
fakeroot.mo File 13.67 KB 0644
fcitx-mozc.mo File 1.25 KB 0644
fetchmail.mo File 91.32 KB 0644
file-roller.mo File 25.61 KB 0644
findutils.mo File 42.78 KB 0644
five-or-more.mo File 4.91 KB 0644
flex.mo File 15.72 KB 0644
fontconfig.mo File 570 B 0644
fprintd.mo File 6.68 KB 0644
friendly-recovery.mo File 5.22 KB 0644
fwupd.mo File 10.33 KB 0644
gODBCConfig.mo File 12.48 KB 0644
gas.mo File 442.21 KB 0644
gawk.mo File 91.75 KB 0644
gcab.mo File 3.48 KB 0644
gcr-4.mo File 12.6 KB 0644
gcr.mo File 17.82 KB 0644
gdata.mo File 11.07 KB 0644
gdb.mo File 261.3 KB 0644
gdbm.mo File 22.9 KB 0644
gdk-pixbuf.mo File 22.19 KB 0644
gdm.mo File 19.16 KB 0644
geary.mo File 50.53 KB 0644
gedit.mo File 73.85 KB 0644
geoclue.mo File 2.05 KB 0644
geocode-glib.mo File 507 B 0644
gettext-runtime.mo File 8.14 KB 0644
gettext-tools.mo File 112.03 KB 0644
gimp20-libgimp.mo File 45.65 KB 0644
gimp20-python.mo File 15.28 KB 0644
gimp20-script-fu.mo File 28.11 KB 0644
gimp20-std-plug-ins.mo File 205.87 KB 0644
gimp20-tips.mo File 13.12 KB 0644
gimp20.mo File 507.08 KB 0644
git-gui-glossary.mo File 2.07 KB 0644
git-gui.mo File 44.12 KB 0644
git.mo File 609.36 KB 0644
glade.mo File 934 B 0644
glance.mo File 108.47 KB 0644
glib-networking.mo File 8.27 KB 0644
glib20.mo File 138.9 KB 0644
gnome-2048.mo File 6.97 KB 0644
gnome-bluetooth-3.0.mo File 6.82 KB 0644
gnome-bluetooth2.mo File 8.09 KB 0644
gnome-calculator.mo File 44.49 KB 0644
gnome-calendar.mo File 22.47 KB 0644
gnome-chess.mo File 23.58 KB 0644
gnome-clocks.mo File 9.25 KB 0644
gnome-color-manager.mo File 12.55 KB 0644
gnome-contacts.mo File 15.93 KB 0644
gnome-control-center-2.0.mo File 178.23 KB 0644
gnome-desktop-3.0.mo File 3.7 KB 0644
gnome-disk-utility.mo File 74.91 KB 0644
gnome-font-viewer.mo File 16.55 KB 0644
gnome-icon-theme.mo File 667 B 0644
gnome-keyring.mo File 9.42 KB 0644
gnome-klotski.mo File 6.63 KB 0644
gnome-logs.mo File 8.61 KB 0644
gnome-mahjongg.mo File 6.5 KB 0644
gnome-maps.mo File 29.25 KB 0644
gnome-menus-3.0.mo File 2.94 KB 0644
gnome-mines.mo File 7.46 KB 0644
gnome-online-accounts.mo File 15.53 KB 0644
gnome-photos.mo File 13.9 KB 0644
gnome-power-manager.mo File 9.01 KB 0644
gnome-remote-desktop.mo File 16 KB 0644
gnome-robots.mo File 9.52 KB 0644
gnome-screenshot.mo File 9.31 KB 0644
gnome-session-47.mo File 9.84 KB 0644
gnome-settings-daemon.mo File 66.38 KB 0644
gnome-shell.mo File 62.08 KB 0644
gnome-software.mo File 111.52 KB 0644
gnome-sound-recorder.mo File 6.38 KB 0644
gnome-sudoku.mo File 7.56 KB 0644
gnome-system-monitor.mo File 30.97 KB 0644
gnome-taquin.mo File 8.76 KB 0644
gnome-terminal.mo File 52.41 KB 0644
gnome-tetravex.mo File 5.33 KB 0644
gnome-text-editor.mo File 22.86 KB 0644
gnome-themes-extra.mo File 918 B 0644
gnome-tweaks.mo File 10.16 KB 0644
gnome-video-effects.mo File 5.49 KB 0644
gnupg2.mo File 210 KB 0644
gnutls.mo File 16.4 KB 0644
gnutls30.mo File 8.02 KB 0644
gold.mo File 82.84 KB 0644
gparted.mo File 51.84 KB 0644
gprof.mo File 10.95 KB 0644
grep.mo File 16.82 KB 0644
grilo.mo File 4.05 KB 0644
grub.mo File 124.97 KB 0644
gsasl.mo File 13.5 KB 0644
gsettings-desktop-schemas.mo File 118.31 KB 0644
gsettings-ubuntu-touch-schemas.mo File 8.7 KB 0644
gspell-1.mo File 2.46 KB 0644
gst-plugins-base-1.0.mo File 20.51 KB 0644
gst-plugins-good-1.0.mo File 13.78 KB 0644
gstreamer-1.0.mo File 40.21 KB 0644
gtk20-properties.mo File 167 KB 0644
gtk20.mo File 57.04 KB 0644
gtk30-properties.mo File 209.26 KB 0644
gtk30.mo File 108.69 KB 0644
gtk40-properties.mo File 162.3 KB 0644
gtk40.mo File 51.53 KB 0644
gtksourceview-3.0.mo File 7.6 KB 0644
gtksourceview-4.mo File 7.11 KB 0644
gtksourceview-5.mo File 8.46 KB 0644
gutenprint.mo File 309.84 KB 0644
gvfs.mo File 41.46 KB 0644
hello.mo File 3.78 KB 0644
help2man.mo File 9.75 KB 0644
hunspell.mo File 10.32 KB 0644
ibus-chewing.mo File 3.24 KB 0644
ibus-hangul.mo File 1.97 KB 0644
ibus-libpinyin.mo File 10.65 KB 0644
ibus-m17n.mo File 1.94 KB 0644
ibus-table.mo File 18.13 KB 0644
ibus-unikey.mo File 4.29 KB 0644
ibus10.mo File 51.77 KB 0644
im-config.mo File 7.96 KB 0644
indent.mo File 5.42 KB 0644
indicator-appmenu.mo File 728 B 0644
indicator-bluetooth.mo File 1.21 KB 0644
indicator-datetime.mo File 1.03 KB 0644
indicator-keyboard.mo File 944 B 0644
indicator-messages.mo File 903 B 0644
indicator-power.mo File 2.34 KB 0644
indicator-printers.mo File 1.8 KB 0644
indicator-session.mo File 2.33 KB 0644
indicator-sound.mo File 1.91 KB 0644
isoquery.mo File 2.94 KB 0644
json-glib-1.0.mo File 2.86 KB 0644
kbd.mo File 42.48 KB 0644
kcm-driver-manager.mo File 6.83 KB 0644
kcm-whoopsie.mo File 2.4 KB 0644
kcm_notificationhelper.mo File 1.78 KB 0644
kdesudo.mo File 4.51 KB 0644
keystone.mo File 51.81 KB 0644
kgx.mo File 7.44 KB 0644
kubuntu-debug-installer.mo File 2.24 KB 0644
kubuntu-patched-l10n.mo File 8.89 KB 0644
landscape-client.mo File 3.95 KB 0644
language-selector.mo File 10.96 KB 0644
language-specs.mo File 1.22 KB 0644
ld.mo File 128.16 KB 0644
lftp.mo File 53.63 KB 0644
libadwaita.mo File 6.57 KB 0644
libapt-inst2.0.mo File 3.88 KB 0644
libapt-pkg5.0.mo File 33.03 KB 0644
libapt-pkg6.0.mo File 34.4 KB 0644
libbytesize.mo File 1.02 KB 0644
libc.mo File 132.98 KB 0644
libcwidget3.mo File 1.41 KB 0644
libdazzle-1.0.mo File 4.27 KB 0644
libdbusmenu.mo File 569 B 0644
libdvbv5.mo File 849 B 0644
libexif-12.mo File 131.75 KB 0644
libgnome-games-support.mo File 1.46 KB 0644
libgnomekbd.mo File 4.21 KB 0644
libgpg-error.mo File 28.11 KB 0644
libgphoto2-2.mo File 194.8 KB 0644
libgphoto2-6.mo File 35.8 KB 0644
libgphoto2_port-0.mo File 13.32 KB 0644
libgpod.mo File 19.29 KB 0644
libgsf.mo File 13.66 KB 0644
libgtop-2.0.mo File 3.16 KB 0644
libgtop.mo File 1.33 KB 0644
libgweather-4.0.mo File 14.55 KB 0644
libhandy.mo File 25.94 KB 0644
libhangul.mo File 3.35 KB 0644
libidn.mo File 8.53 KB 0644
libidn2.mo File 6.76 KB 0644
libnma.mo File 15.52 KB 0644
libpanel.mo File 2.63 KB 0644
libpeas.mo File 2.78 KB 0644
libpwquality.mo File 6.39 KB 0644
libsecret.mo File 1.62 KB 0644
libsmbios.mo File 20.55 KB 0644
libsoup-3.0.mo File 4.21 KB 0644
libsoup.mo File 4.46 KB 0644
libvisual-0.4.mo File 19.03 KB 0644
libvisual-plugins-0.4.mo File 10.98 KB 0644
libwnck-3.0.mo File 20.28 KB 0644
live-build.mo File 26.48 KB 0644
live-helper.mo File 29.32 KB 0644
lshw.mo File 17.13 KB 0644
ltsp-live.mo File 2.38 KB 0644
ltsp-login.mo File 767 B 0644
ltsp.mo File 12.6 KB 0644
luksformat.mo File 1.71 KB 0644
lvm2.mo File 132.29 KB 0644
m17n-db.mo File 16.11 KB 0644
main.mo File 9.76 KB 0644
make.mo File 40.29 KB 0644
man-db-gnulib.mo File 4.05 KB 0644
man-db.mo File 20.05 KB 0644
mit-krb5.mo File 612 B 0644
monitoring-plugins.mo File 16.61 KB 0644
mousetweaks.mo File 3.3 KB 0644
mutt.mo File 90.67 KB 0644
mutter.mo File 17.97 KB 0644
nano.mo File 60.01 KB 0644
nautilus-sendto.mo File 1.6 KB 0644
nautilus-share.mo File 4.45 KB 0644
nautilus.mo File 99.99 KB 0644
ndisc6.mo File 15.98 KB 0644
neon.mo File 13.59 KB 0644
net-tools.mo File 57.02 KB 0644
network-manager-applet.mo File 1.13 KB 0644
newt.mo File 584 B 0644
nm-applet.mo File 83.96 KB 0644
notification-daemon.mo File 1.48 KB 0644
notificationhelper.mo File 3.64 KB 0644
nss_db.mo File 2.52 KB 0644
opcodes.mo File 26.63 KB 0644
orca.mo File 111.41 KB 0644
org.gnome.Characters.mo File 4.35 KB 0644
p11-kit.mo File 29.71 KB 0644
papers.mo File 29.32 KB 0644
parted.mo File 72.6 KB 0644
pastebinit.mo File 1.92 KB 0644
patches.mo File 914 B 0644
pipewire.mo File 4.98 KB 0644
plymouth.mo File 968 B 0644
polkit-1.mo File 677 B 0644
polkit-gnome-1.mo File 2.43 KB 0644
popt.mo File 2.41 KB 0644
powertop.mo File 9.32 KB 0644
pppconfig.mo File 30.35 KB 0644
pppoeconf.mo File 12.09 KB 0644
procps-ng.mo File 96.24 KB 0644
psmisc.mo File 18.66 KB 0644
ptyxis.mo File 34.57 KB 0644
pulseaudio.mo File 73.85 KB 0644
python-apt.mo File 7.62 KB 0644
quadrapassel.mo File 7.82 KB 0644
quota.mo File 57.68 KB 0644
realmd.mo File 13.97 KB 0644
recode.mo File 7.46 KB 0644
remmina.mo File 41.19 KB 0644
rhash.mo File 9.37 KB 0644
rhythmbox.mo File 75.63 KB 0644
rrdtool.mo File 12.89 KB 0644
rygel.mo File 29.07 KB 0644
sane-backends.mo File 84.35 KB 0644
schroot.mo File 7.81 KB 0644
screen-resolution-extra.mo File 2.43 KB 0644
seahorse.mo File 44.69 KB 0644
sed.mo File 15.71 KB 0644
shadow.mo File 62.08 KB 0644
shared-mime-info.mo File 47.59 KB 0644
sharutils.mo File 28.32 KB 0644
shotwell.mo File 119.96 KB 0644
simple-scan.mo File 20.78 KB 0644
slideshow-oem-config-ubuntu-budgie.mo File 6.36 KB 0644
slideshow-oem-config-ubuntu-mate.mo File 13.36 KB 0644
slideshow-ubuntu-budgie.mo File 6.36 KB 0644
slideshow-ubuntu-mate.mo File 13.38 KB 0644
slideshow-ubuntu.mo File 7.25 KB 0644
slideshow-ubuntukylin.mo File 2.08 KB 0644
slideshow-ubuntustudio.mo File 5 KB 0644
snappy.mo File 148.18 KB 0644
software-properties.mo File 34.27 KB 0644
sound-theme-freedesktop.mo File 536 B 0644
speech-dispatcher.mo File 1010 B 0644
sssd-docs.mo File 399.54 KB 0644
sssd.mo File 72.2 KB 0644
styles.mo File 1.45 KB 0644
subdomain_parser.mo File 10.2 KB 0644
sudo.mo File 16.66 KB 0644
sudoers.mo File 29.06 KB 0644
sushi.mo File 1.53 KB 0644
swell-foop.mo File 6.67 KB 0644
swift.mo File 24.38 KB 0644
synaptic-manual.mo File 64.68 KB 0644
synaptic.mo File 66.46 KB 0644
sysprof.mo File 14.86 KB 0644
sysstat.mo File 4.62 KB 0644
system-config-printer.mo File 72.53 KB 0644
systemd.mo File 24.6 KB 0644
tali.mo File 8.35 KB 0644
tar.mo File 62.83 KB 0644
tasksel.mo File 562 B 0644
tecla.mo File 940 B 0644
texinfo.mo File 111 KB 0644
texinfo_document.mo File 16.92 KB 0644
[email protected] File 9.76 KB 0644
tmispell-voikko.mo File 8.24 KB 0644
totem-pl-parser.mo File 1.08 KB 0644
totem.mo File 29.11 KB 0644
tracker-miners.mo File 11.57 KB 0644
transmission-gtk.mo File 43.81 KB 0644
ubiquity-debconf.mo File 42.46 KB 0644
ubiquity-desktop.mo File 1 KB 0644
ubiquity-slideshow-kubuntu.mo File 7.23 KB 0644
ubiquity-slideshow-oem-config-ubuntu.mo File 7.23 KB 0644
ubiquity-slideshow-xubuntu.mo File 4.2 KB 0644
ubuntu-advantage-desktop-daemon.mo File 1.58 KB 0644
ubuntu-advantage.mo File 1.72 KB 0644
ubuntu-default-launchers.mo File 560 B 0644
ubuntu-release-upgrader.mo File 44.63 KB 0644
ubuntu-wallpapers.mo File 15.12 KB 0644
ufw.mo File 17.29 KB 0644
unattended-upgrades.mo File 11.05 KB 0644
unity-control-center.mo File 87.39 KB 0644
unity-doc.mo File 4.11 KB 0644
unity-greeter.mo File 3.98 KB 0644
unity-lens-applications.mo File 4.98 KB 0644
unity-lens-files.mo File 3.68 KB 0644
unity-lens-music.mo File 2.93 KB 0644
unity-lens-photos.mo File 4.63 KB 0644
unity-lens-video.mo File 2.27 KB 0644
unity-scope-calculator.mo File 1.33 KB 0644
unity-scope-devhelp.mo File 1.32 KB 0644
unity-scope-home.mo File 5.66 KB 0644
unity-scope-manpages.mo File 1.41 KB 0644
unity-settings-daemon.mo File 34.09 KB 0644
unity.mo File 29.07 KB 0644
update-manager.mo File 16.39 KB 0644
update-motd.mo File 678 B 0644
update-notifier.mo File 12.49 KB 0644
upower.mo File 1.36 KB 0644
usbcreator.mo File 4.5 KB 0644
util-linux.mo File 381.95 KB 0644
v4l-utils.mo File 3.68 KB 0644
vim.mo File 271.48 KB 0644
vino.mo File 15.86 KB 0644
volume_key.mo File 14.87 KB 0644
vte-2.91.mo File 1.31 KB 0644
w3m.mo File 17.13 KB 0644
wdiff-gnulib.mo File 2.94 KB 0644
wdiff.mo File 16.57 KB 0644
wget.mo File 79.57 KB 0644
whois.mo File 9.13 KB 0644
whoopsie-preferences.mo File 686 B 0644
wireplumber.mo File 684 B 0644
xdg-desktop-portal-gnome.mo File 5.61 KB 0644
xdg-desktop-portal-gtk.mo File 5.41 KB 0644
xdg-user-dirs-gtk.mo File 1.82 KB 0644
xdg-user-dirs.mo File 1.53 KB 0644
xen-xm.mo File 1.54 KB 0644
xfsdump.mo File 79.68 KB 0644
xfsprogs.mo File 100.65 KB 0644
xkeyboard-config.mo File 82.88 KB 0644
xz-man.mo File 1.13 KB 0644
xz.mo File 30.55 KB 0644
yelp-xsl.mo File 3.59 KB 0644
yelp.mo File 6.54 KB 0644
zenity.mo File 14.33 KB 0644
zenmap.mo File 58.52 KB 0644
zsys.mo File 7.34 KB 0644
Filemanager